PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_27397_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family HD-ZIP
Protein Properties Length: 461aa    MW: 51429.3 Da    PI: 6.5164
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_27397_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.41.6e-2091146156
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     +++ +++t++q++e+e++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k
  Neem_27397_f_1  91 KKRYHRHTQHQIQEMETFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMK 146
                     688999***********************************************999 PP

2START161.27.5e-512804581164
                     HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEE CS
           START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetl 82 
                     ela +a++el+++a+ ++p+W++      + +n++e++++f+++ +     ++ ea+r+s+vv+m++  lve+l+d++ qW++ +     +a+tl
  Neem_27397_f_1 280 ELAVAAMEELFRMAQMGQPLWMTGLdgttSVLNEEEYVRTFPRGIGpkptgFKCEASRESAVVIMNHISLVEILMDVN-QWSTVFSgivsRAMTL 373
                     57899********************999999************999********************************.**************** PP

                     EEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEE CS
           START  83 evissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskv 164
                     ev+s+g      galq+m++e+q++splvp R++++vRy++q+g+g+w++vdvS+d+ ++ p     vR++++pSg+li++++ng+skv
  Neem_27397_f_1 374 EVLSTGvagnynGALQVMTSEFQVPSPLVPtRESYYVRYCKQHGEGTWAVVDVSLDNLRPSPA----VRCRRRPSGCLIQEMPNGYSKV 458
                     ************************************************************995....*********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.7E-2370146IPR009057Homeodomain-like
SuperFamilySSF466891.21E-1979148IPR009057Homeodomain-like
PROSITE profilePS5007116.7388148IPR001356Homeobox domain
SMARTSM003891.8E-1989152IPR001356Homeobox domain
CDDcd000862.05E-1891149No hitNo description
PfamPF000464.1E-1891146IPR001356Homeobox domain
PROSITE patternPS000270123146IPR017970Homeobox, conserved site
PROSITE profilePS5084832.91271461IPR002913START domain
SuperFamilySSF559611.22E-26271458No hitNo description
CDDcd088751.68E-101275458No hitNo description
SMARTSM002341.1E-27280460IPR002913START domain
PfamPF018526.1E-41281458IPR002913START domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 461 aa     Download sequence    Send to blast
MPTGVMIPAR NMPSVIGRNG NVGGLGSSSG GLSLSQPNMM EGQLHPLDMT QNTSESEIAR  60
LREEEFDSTK SGSENHEGAS GDDQEQQPPK KKRYHRHTQH QIQEMETFFK ECPHPDDKQR  120
KELSRELGLE PLQVKFWFQN KRTQMKTQHE RHENTQLRAE NEKLRADNMR YREALSNASC  180
PNCGGPTAIG EMSFDEHHLR LENARLREEI DRISAIAAKY VGKPVVNYPL LSPPVPPRPL  240
ELGVGNFGGQ PGMGGEMYGA ADLLRSINTP TEADKPMIIE LAVAAMEELF RMAQMGQPLW  300
MTGLDGTTSV LNEEEYVRTF PRGIGPKPTG FKCEASRESA VVIMNHISLV EILMDVNQWS  360
TVFSGIVSRA MTLEVLSTGV AGNYNGALQV MTSEFQVPSP LVPTRESYYV RYCKQHGEGT  420
WAVVDVSLDN LRPSPAVRCR RRPSGCLIQE MPNGYSKVNK F
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4778243e-67AM477824.1 Vitis vinifera contig VV78X054788.8, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015383008.10.0PREDICTED: homeobox-leucine zipper protein HDG2 isoform X2
RefseqXP_006447539.10.0hypothetical protein CICLE_v10014373mg
RefseqXP_006447538.10.0hypothetical protein CICLE_v10014373mg
RefseqXP_006447537.10.0hypothetical protein CICLE_v10014373mg
SwissprotQ0J9X20.0ROC2_ORYSJ; Homeobox-leucine zipper protein ROC2
SwissprotQ93V990.0PDF2_ARATH; Homeobox-leucine zipper protein PROTODERMAL FACTOR 2
TrEMBLV4W4610.0V4W461_9R
STRINGVIT_12s0059g02310.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49128149
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G05230.40.0homeodomain GLABROUS 2